PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009773781.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 685aa    MW: 79086 Da    PI: 6.9518
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009773781.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK54.91.8e-17509556350
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkik 50 
                     ++++ +dl+++F++++ dAA +L+v+ ++LKr CR+yGI+RWP  k k
  XP_009773781.1 509 DTVNYDDLKQHFNKNLSDAAESLQVSRSTLKRLCRKYGIRRWPLSKRK 556
                     678999*************************************87655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.243495580IPR003035RWP-RK domain
PfamPF020422.6E-17511557IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.601.9E-5520547IPR009057Homeodomain-like
SuperFamilySSF542775.05E-16587676No hitNo description
Gene3DG3DSA:3.10.20.2402.2E-15592676No hitNo description
SMARTSM006663.9E-7595677IPR000270PB1 domain
PROSITE profilePS5174517.806595677IPR000270PB1 domain
PfamPF005646.8E-12596675IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MQGIEKSQFP VNDDVVYEVY TSSEFKNYMG ESLSCSEERS NFHLMVFWSN NETESNFTNN  60
LIETSVKQKI KAALQRIETS QVILLQFWGL EKIEGRNFLT TAGQPFGLRY LYKGLCWYRK  120
HCQGYKYSVN NKGESGEQGT EKVHLFGPPA RVFQEKLPES STHVGYYTNE EFPIRDHAVR  180
CGVRTYLALP VFEPIGKKCV GVIELVTVWK GGYLTYEVEK VLNALEGVDL KCPKLYLQKG  240
RKVQEGKQSD REEIKRMLKI VRETHKLPFV RVWIPYEEMD ANDHVYDDYY YDDMLCFRDI  300
SKLQPLQKDQ GVVGKAFFSG KLCYCENITE FSIIEYPLVH YARWCGLTSS FAICLKNGVE  360
VYILELFLPP DNGDPEILLG SILSTMGQHF QNFKFASGQE LGHDSSVQVI KAYSDKNVDY  420
FHICQTRESL FMPEVLCDEE RRNWLMKGNE NHTEKEAISE CTIQNSVDNG QQQIMVQSDV  480
LNTDIQVISE KQCVSVTHFQ KESRTRTKDT VNYDDLKQHF NKNLSDAAES LQVSRSTLKR  540
LCRKYGIRRW PLSKRKKTLG ESDYQPLNML PKKKKAITSA TTSTHENHGN SSSSSITVKA  600
TYGDDMMKFK LYSFSRKEDL DKELDKRLQL PIGKFRTKYM DEDNDYIWIA CDDDLRDCFN  660
NALSLGKNTI KMLVLPAAIN HSLEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1554574RKKTLGESDYQPLNMLPKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773781.10.0PREDICTED: protein NLP7-like isoform X2
RefseqXP_016507148.10.0PREDICTED: protein NLP7-like isoform X2
TrEMBLM1AWJ60.0M1AWJ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319410.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.12e-82NIN like protein 7